PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_00576.1_g00026.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family Dof
Protein Properties Length: 302aa    MW: 31819.7 Da    PI: 7.1346
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_00576.1_g00026.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof1222e-3849109262
                   zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62 
                              ++++lkcprC s ntkfCyynny+lsqPr+fCk+CrryWtkGG lrnvPvGgg+rk k+s+
  Rsa1.0_00576.1_g00026.1  49 HHQSLKCPRCSSLNTKFCYYNNYNLSQPRHFCKNCRRYWTKGGVLRNVPVGGGCRKAKRSK 109
                              57899*****************************************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074781.0E-3340107IPR003851Zinc finger, Dof-type
PfamPF027017.1E-3351107IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.36653107IPR003851Zinc finger, Dof-type
PROSITE patternPS0136105591IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 302 aa     Download sequence    Send to blast
MQDIHDYSMT GGGGSGGSTG RFYGGGIGGG GGGGGDRRMR THQNSILNHH QSLKCPRCSS  60
LNTKFCYYNN YNLSQPRHFC KNCRRYWTKG GVLRNVPVGG GCRKAKRSKS KQPTSSSPSS  120
ADKPTTQNVE EKSSSSESSS LTASNSTVTA SNATVSAVAV TATVASSSGV MDTDMPNLKQ  180
YGNGIEWSTL LGQGSSDGGA FSEIGCFTAA STVETTPFGL GGTFVNQQSI ADHLKLEGNT  240
LPQQFGDPTA QVDPNMGFEP LDWGSGGGDQ TLFDLTSSVD HAYWSQSQWA SSDQDQNGLY  300
LP
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00570DAPTransfer from AT5G60850Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009136402.11e-166PREDICTED: dof zinc finger protein DOF5.4
SwissprotQ8LDR01e-136DOF54_ARATH; Dof zinc finger protein DOF5.4
TrEMBLM4D9431e-166M4D943_BRARP; Uncharacterized protein
STRINGBra013003.1-P1e-165(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM44822656
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60850.12e-55OBF binding protein 4